SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000470060 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470060
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-26
Family cAMP-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470060   Gene: ENSG00000032444   Transcript: ENST00000594551
Sequence length 192
Comment pep:putative chromosome:GRCh37:19:7604924:7606518:1 gene:ENSG00000032444 transcript:ENST00000594551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPG
PDGKECVVKEVVPGDSVNSLLSILDVITHPQRTVSARAARDSTVLRLPVEAFSAVFTKYP
ESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTRTSPVRGSKR
MVSTSATDEPRE
Download sequence
Identical sequences M0QYT1
ENSP00000470060 ENSP00000470060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]