SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470516 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470516
Domain Number 1 Region: 18-99
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.52e-25
Family Synaptotagmin-like (S variant) 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470516   Gene: ENSG00000132872   Transcript: ENST00000596867
Sequence length 103
Comment pep:putative chromosome:GRCh37:18:40850465:40857455:-1 gene:ENSG00000132872 transcript:ENST00000596867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVN
LYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVE
Download sequence
Identical sequences A0A2J8MMK8 A0A2J8XF77 M0QZF3
ENSP00000470516 ENSP00000470516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]