SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471558 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471558
Domain Number 1 Region: 534-623
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000118
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 2 Region: 442-537
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000302
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 3 Region: 84-136
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000536
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 16-77
Classification Level Classification E-value
Superfamily Sema domain 0.0000000216
Family Sema domain 0.031
Further Details:      
 
Domain Number 5 Region: 622-666,704-757
Classification Level Classification E-value
Superfamily E set domains 0.0000000864
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 
Domain Number 6 Region: 771-852
Classification Level Classification E-value
Superfamily E set domains 0.0000202
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Weak hits

Sequence:  ENSP00000471558
Domain Number - Region: 238-270
Classification Level Classification E-value
Superfamily Plexin repeat 0.0968
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471558   Gene: ENSG00000268591   Transcript: ENST00000598993
Sequence length 988
Comment pep:known chromosome:GRCh37:HG1497_PATCH:152933974:152943710:1 gene:ENSG00000268591 transcript:ENST00000598993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHAAQETPLLHHFMDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADG
HMIAFLGDTQGQLYKVDRIPVAACPQFPDCASCLQAQDPLCGWCVLQGRCTRKGQCGRAG
QLNQWLWSYEEDSHCLHIQSLLPGHHPRQEQGQVTLSVPRLPILDADEYFHCAFGDYDSL
AHVEGPHVACVTPPQDQVPLNPPGTDHVTVPLALMFEDVTVAATNFSFYDCSAVQALEAA
APCRACVGSIWRCHWCPQSSHCVYGEHCPEGERTIYSAQEVDIQVRGPGACPQVEGLAGP
HLVPVGWESHLALRVRNLQHFRGLPASFHCWLELPGELRGLPATLEETAGDSGLIHCQAH
QFYPSMSQRELPVPIYVTQGEAQRLDNTHALYVILYDCAMGHPDCSHCQAANRSLGCLWC
ADGQPACRYGPLCPPGAVELLCPAPSIDAVEPLTGPPEGGLALTILGSNLGRAFADVQYA
VSVASRPCNPEPSLYRTSARIVCVTSPAPNGTTGPVRVAIKSQPPGISSQHFTYQDPVLL
SLSPRWGPQAGGTQLTIRGQHLQTGGNTSAFVGGQPCPILEPVCPEAIVCRTRPQAAPGE
AAVLVVFGHAQRTLLASPFRYTANPQLVAAEPSASFRGGGRLIRVRGTGLDVVQRPLLSV
WLEADAEVQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRS
PAVPDRAHPQRVFFTLDNVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVL
DVEGEGLNLGISKEEVRVHIGRGECLVKTLTRTHLYCEPPAHAPQPANGSGLPQFVVQMG
NVQLALGPVQYEAEPPLSAFPVEAQAGVGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKV
LVQLESLETGVGDQCRKEFTGGCGGGGTGYPRGLNSHLGASWPRRPHDGDDRPQQRPGGQ
RDPLPGLPHLRRARLLPWPWRLPAAAQA
Download sequence
Identical sequences ENSP00000441919 ENSP00000471558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]