SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471872 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471872
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily E set domains 3.74e-18
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 144-231
Classification Level Classification E-value
Superfamily E set domains 0.00000000147
Family Filamin repeat (rod domain) 0.00093
Further Details:      
 
Domain Number 3 Region: 2-28
Classification Level Classification E-value
Superfamily E set domains 0.0000734
Family Filamin repeat (rod domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471872   Gene: ENSG00000269329   Transcript: ENST00000601317
Sequence length 232
Comment pep:novel chromosome:GRCh37:HG1497_PATCH:153521764:153523357:-1 gene:ENSG00000269329 transcript:ENST00000601317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPL
VGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEA
GLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGD
DSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHV
Download sequence
Identical sequences H0Y5F3
ENSP00000398215 ENSP00000471872 ENSP00000398215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]