SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471976 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000471976
Domain Number - Region: 72-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0131
Family cAMP-binding domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471976   Gene: ENSG00000268394   Transcript: ENST00000597879
Sequence length 160
Comment pep:known chromosome:GRCh37:HG1436_HG1432_PATCH:48381255:48387644:1 gene:ENSG00000268394 transcript:ENST00000597879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTNAGPLHPYWPQHLRLDNFVPNDRPTWHILAGLFSVTGVLVVTTWLLSGRAAVVPLGT
WRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVC
METITACLWGPLSLWVVIAFLRQHPLRFILQLVVSVGQIY
Download sequence
Identical sequences C9JJ78
ENSP00000390031 ENSP00000390031 ENSP00000471976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]