SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000472631 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472631
Domain Number 1 Region: 128-180
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000138
Family cAMP-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472631   Gene: ENSG00000032444   Transcript: ENST00000601001
Sequence length 181
Comment pep:known chromosome:GRCh37:19:7599085:7605140:1 gene:ENSG00000032444 transcript:ENST00000601001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPLQTGMVLGVMIGAGVAVVVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYG
RKIMRKVSQSTSSLVDTSVSATSRPRMRKKLKMLNIAKKILRIQKETPTLQRKEPPPAVL
EADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQP
D
Download sequence
Identical sequences M0R2K2
ENSP00000472631 ENSP00000472631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]