SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000474611 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000474611
Domain Number - Region: 16-128
Classification Level Classification E-value
Superfamily E set domains 0.0168
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000474611   Gene: ENSG00000122958   Transcript: ENST00000489794
Sequence length 226
Comment pep:novel chromosome:GRCh37:10:70892654:70931115:1 gene:ENSG00000122958 transcript:ENST00000489794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNT
HEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVK
EYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQ
HMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGDNFMEKSS
Download sequence
Identical sequences A0A2J8NV00 A0A2J8RN59 S4R3Q6
ENSP00000474611 ENSP00000474611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]