SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000476273 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000476273
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000391
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476273   Gene: ENSG00000159263   Transcript: ENST00000483178
Sequence length 73
Comment pep:putative chromosome:GRCh37:21:38084866:38092888:1 gene:ENSG00000159263 transcript:ENST00000483178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGKIMYISETASVHLGLSQVELTGNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQGIPSR
GKKKNRLKARRHS
Download sequence
Identical sequences V9GY04
ENSP00000476273 ENSP00000476273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]