SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000477100 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477100
Domain Number 1 Region: 8-84,135-205
Classification Level Classification E-value
Superfamily E set domains 1.68e-21
Family Arrestin/Vps26-like 0.016
Further Details:      
 
Domain Number 2 Region: 207-322
Classification Level Classification E-value
Superfamily E set domains 4.27e-21
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477100   Gene: ENSG00000105643   Transcript: ENST00000593560
Sequence length 322
Comment pep:putative chromosome:GRCh37:19:18118977:18120839:1 gene:ENSG00000105643 transcript:ENST00000593560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
ESRSAGSSTAYTQSYSERVEVVSHRATLLAPGTDGGPLLQHQLCASHHLDGGTSVSPGTP
AQPLSRLLFLLPADTGETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRP
WVPARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCNRGLVSLSAKIDRKGYTPG
EVIPVFAEIDNGSTRPVLPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQG
RALRIPPVGPSILHCRVLHVDY
Download sequence
Identical sequences V9GYU7
ENSP00000477100 ENSP00000477100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]