SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000477142 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477142
Domain Number 1 Region: 180-356
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.15e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000109
Further Details:      
 
Domain Number 2 Region: 358-458
Classification Level Classification E-value
Superfamily E set domains 6.16e-32
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477142   Gene: ENSG00000101096   Transcript: ENST00000610033
Sequence length 702
Comment pep:putative chromosome:GRCh37:20:50007765:50159258:-1 gene:ENSG00000101096 transcript:ENST00000610033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQP
SSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKA
GLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEW
PLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIF
IGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGIL
KLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPM
VERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLF
VEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTH
GGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLS
PSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQ
LRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGP
PVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNIL
Download sequence
Identical sequences NP_001245223.1.87134 NP_001245223.1.92137 NP_001245225.1.87134 NP_001245225.1.92137 ENSP00000477142 ENSP00000477342 ENSP00000477142 ENSP00000477342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]