SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000217289 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000217289
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-18
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 271-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000301
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000217289
Domain Number - Region: 508-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000157
Family Second domain of FERM 0.0045
Further Details:      
 
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00114
Family Ubiquitin-related 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000217289   Gene: ENSG00000101311   Transcript: ENST00000217289
Sequence length 677
Comment pep:known chromosome:GRCh37:20:6055492:6104191:-1 gene:ENSG00000101311 transcript:ENST00000217289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
VTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQD
Download sequence
Identical sequences Q9BQL6
ENSP00000217289 NP_060141.3.87134 NP_060141.3.92137 9606.ENSP00000217289 ENSP00000217289 ENSP00000217289 NYSGRC-116686114 gi|116686114|ref|NP_060141.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]