SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000218054 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000218054
Domain Number 1 Region: 113-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000387
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 257-324
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000471
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 35-101
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000023
Family VWC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000218054   Gene: ENSG00000101938   Transcript: ENST00000218054
Sequence length 456
Comment pep:known chromosome:GRCh37:X:109917092:110039076:-1 gene:ENSG00000101938 transcript:ENST00000218054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGT
TYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRG
DGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQ
ASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKI
HCPNRYPCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFMEDGET
TRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFT
EGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences A0A2J8KYC6
NP_660277.2.87134 NP_660277.2.92137 ENSP00000378276 ENSP00000218054 ENSP00000378276 gi|34147715|ref|NP_660277.2| NYSGRC-34147715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]