SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000252456 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000252456
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.6e-51
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000252456   Gene: ENSG00000130176   Transcript: ENST00000252456
Sequence length 297
Comment pep:known chromosome:GRCh37:19:11649532:11661138:1 gene:ENSG00000130176 transcript:ENST00000252456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
Download sequence
Identical sequences A0A2J8RYK0 G3S3B2 H2QFE4 P51911 V9HWA5
ENSP00000252456 9598.ENSPTRP00000017928 9606.ENSP00000252456 ENSP00000252456 NP_001290.2.87134 NP_001290.2.92137 ENSGGOP00000022562 ENSPTRP00000017928 ENSGGOP00000022562 gi|21361120|ref|NP_001290.2| ENSPTRP00000017928 ENSP00000252456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]