SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000262605 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262605
Domain Number 1 Region: 122-301
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.67e-50
Family CRAL/TRIO domain 0.0000387
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.29e-21
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262605   Gene: ENSG00000124120   Transcript: ENST00000262605
Sequence length 342
Comment pep:known chromosome:GRCh37:20:43104526:43123244:1 gene:ENSG00000124120 transcript:ENST00000262605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQA
LRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQV
NGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIK
PFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGELDTATWNAVLLASEDDFVKE
FCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY
Download sequence
Identical sequences G3QQ35 Q9BTX7
ENSGGOP00000004693 ENSP00000262605 ENSP00000361995 9606.ENSP00000262605 ENSP00000262605 ENSP00000262605 ENSP00000361995 NP_001034288.1.87134 NP_001034288.1.92137 NP_077307.2.87134 NP_077307.2.92137 XP_004062248.1.27298 XP_011527345.1.92137 XP_011527346.1.92137 XP_018872576.1.27298 ENSGGOP00000004693 gi|85861243|ref|NP_001034288.1| gi|85861250|ref|NP_077307.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]