SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000264818 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264818
Domain Number 1 Region: 887-1166
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-70
Family Protein kinases, catalytic subunit 0.00000763
Further Details:      
 
Domain Number 2 Region: 576-879
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.07e-44
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 452-553,582-607
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000225
Family SH2 domain 0.0058
Further Details:      
 
Domain Number 4 Region: 376-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000467
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 141-266
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000523
Family Second domain of FERM 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264818   Gene: ENSG00000105397   Transcript: ENST00000264818
Sequence length 1187
Comment pep:known chromosome:GRCh37:19:10461209:10489082:-1 gene:ENSG00000105397 transcript:ENST00000264818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
Download sequence
Identical sequences A0A024R7E4 P29597
gi|187608615|ref|NP_003322.3| ENSP00000264818 ENSP00000431885 9606.ENSP00000264818 ENSP00000264818 ENSP00000264818 ENSP00000431885 NP_003322.3.87134 NP_003322.3.92137 XP_011526547.1.92137 HR3347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]