SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265198 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265198
Domain Number 1 Region: 20-139
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-37
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265198   Gene: ENSG00000074706   Transcript: ENST00000265198
Sequence length 437
Comment pep:known chromosome:GRCh37:6:154475744:154677900:-1 gene:ENSG00000074706 transcript:ENST00000265198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYMAIDGSALVPLRQKPRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSN
KWKKFWVILKGSSLYWYSNQMAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYF
AAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTA
QQASSSSPSLSGTSYSFSSLENTVKTPSSFPSSLSKERQSLPDTVNSLSAAEDEGQPITF
AVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIM
DKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIR
TLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDT
PQELKKSPSSPSVENSI
Download sequence
Identical sequences Q8WWN9
ENSP00000265198 gi|40354212|ref|NP_056368.1| ENSP00000265198 NP_056368.1.87134 NP_056368.1.92137 XP_005266980.1.92137 XP_011534044.1.92137 XP_016866207.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]