SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000268125 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000268125
Domain Number 1 Region: 41-306
Classification Level Classification E-value
Superfamily PDB 5.1e-88
Family PDB 0.000000000188
Further Details:      
 
Domain Number 2 Region: 140-297
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.54e-61
Family CRAL/TRIO domain 0.0014
Further Details:      
 
Domain Number 3 Region: 46-124
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.05e-18
Family SCOPe 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000268125   Gene: ENSG00000140522   Transcript: ENST00000268125
Sequence length 317
Comment pep:known chromosome:GRCh37:15:89753100:89764982:-1 gene:ENSG00000140522 transcript:ENST00000268125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETRE
EAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNF
RLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAY
CFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHF
IHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKA
VAEQLFGPQAQAENTAF
Download sequence
Identical sequences A0A2K5HRF4 P12271
GO.38705 ENSP00000268125 NP_000317.1.87134 NP_000317.1.92137 XP_011520172.1.92137 XP_011803708.1.43180 ENSP00000268125 ENSP00000268125 gi|4506541|ref|NP_000317.1| 4ciz_A 9606.ENSP00000268125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]