SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000278947 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000278947
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-19
Family V set domains (antibody variable domain-like) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000278947   Gene: ENSG00000149575   Transcript: ENST00000278947
Sequence length 215
Comment pep:known chromosome:GRCh37:11:118032666:118047388:-1 gene:ENSG00000149575 transcript:ENST00000278947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Download sequence
Identical sequences A0A2I3HIW5 O60939 Q5U0K8
ENSP00000278947 ENSNLEP00000008973 ENSGGOP00000002064 NP_004579.1.87134 NP_004579.1.92137 XP_003253266.1.23891 9606.ENSP00000278947 gi|4759066|ref|NP_004579.1| ENSP00000278947 ENSNLEP00000008973 ENSGGOP00000002064 ENSP00000278947 NYSGRC-IgSF-SCN2B_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]