SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000296604 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296604
Domain Number 1 Region: 281-411
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-34
Family Ran-binding domain 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296604   Gene: ENSG00000164188   Transcript: ENST00000296604
Sequence length 465
Comment pep:known chromosome:GRCh37:5:36248536:36302004:-1 gene:ENSG00000164188 transcript:ENST00000296604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEA
AEPECNGFPTKRVRSSSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSK
HVIRPAILQLPQARSCAKVRKTFGHKALESCKTKEKTNNKISEGNSYLLSENLSRARISV
QLSTNQDFLGATSVGCQPNEDKCSFKSCSSNFVFGENMVERVLGTQKLTQPQLENDSYAK
EKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSRKCLLEKIDVITGEETEHNVL
KINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLRLILNSKLWAQ
MKIQRANHKNVRITATDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQ
AESLSETAQQLNCESCDENEDDFIQVTKNGSDPSSWTHRQSVACS
Download sequence
Identical sequences Q86VV4
NP_659437.3.87134 NP_659437.3.92137 gi|239582743|ref|NP_659437.3| ENSP00000296604 9606.ENSP00000296604 ENSP00000296604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]