SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000303508 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000303508
Domain Number 1 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-38
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-31
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-26
Family First domain of FERM 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000303508   Gene: ENSG00000172159   Transcript: ENST00000304195
Sequence length 597
Comment pep:known chromosome:GRCh37:9:85859537:86153353:-1 gene:ENSG00000172159 transcript:ENST00000304195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANI
TQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSSPVKA
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLL
FVFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS
Download sequence
Identical sequences A2A2Y4
9606.ENSP00000303508 NP_777598.3.87134 NP_777598.3.92137 ENSP00000303508 ENSP00000365621 HR5621 HR6168 gi|117500790|ref|NP_777598.3| ENSP00000303508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]