SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000309689 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309689
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 3.97e-40
Family Internalin LRR domain 0.035
Further Details:      
 
Domain Number 2 Region: 539-631
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-25
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309689   Gene: ENSG00000077454   Transcript: ENST00000310300
Sequence length 683
Comment pep:known chromosome:GRCh37:7:100172283:100183776:-1 gene:ENSG00000077454 transcript:ENST00000310300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAPLAAGGEEAAATTSVPGSPGLPGRRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSLLPPYICQLPLRVLIVSNNKLGALPPDIGTLGSLRQLDVSSNELQSLPSELCG
LSSLRDLNVRRNQLSTLPEELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQVCLKGKLHIFKYLSTEAGQRGSALGDLAPSRPPSFSPCPAEDLFPGHRYDGGLDS
GFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSH
VPGEDEERGTVEEQRPPELSPGAGDRERAPSSRREEPAGEERRRPDTLQLWQERERRQQQ
QSGAWGAPRKDSLLKPGLRAVVGGAAAVSTQAMHNGSPKSSASQAGAAAGQGAPAPAPAS
QEPLPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDL
MTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPSPAVPKLSALKA
RKNVESFLEACRKMGVPEADLCSPSDLLQGTARGLRTALEAVKRVGGKALPPLWPPSGLG
GFVVFYVVLMLLLYVTYTRLLGS
Download sequence
Identical sequences O75427
NP_002310.2.87134 NP_002310.2.92137 ENSP00000309689 ENSP00000419674 9606.ENSP00000309689 gi|30181233|ref|NP_002310.2| ENSP00000309689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]