SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000317597 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317597
Domain Number 1 Region: 186-329
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 82-187
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-36
Family Second domain of FERM 0.000000825
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.44e-26
Family First domain of FERM 0.00000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317597   Gene: ENSG00000159023   Transcript: ENST00000349460
Sequence length 641
Comment pep:known chromosome:GRCh37:1:29213636:29443626:1 gene:ENSG00000159023 transcript:ENST00000349460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAK
EIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLG
SYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLEN
AKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFI
KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRY
SGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQV
AEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKVEKTHIEVTVPTSN
GDQTQKKRERLDGENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSE
WDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETK
TITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVIT
GDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEIADE
Download sequence
Identical sequences ENSP00000317597 ENSP00000317597 NP_976217.1.87134 NP_976217.1.92137 gi|42716291|ref|NP_976217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]