SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000324767 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000324767
Domain Number 1 Region: 323-408
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000167
Family Calponin-homology domain, CH-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000324767   Gene: ENSG00000176034   Transcript: ENST00000313548
Sequence length 502
Comment pep:known chromosome:GRCh37:X:36065053:36163187:1 gene:ENSG00000176034 transcript:ENST00000313548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIHLDKQNIILKNDKDEYLKKTRDGVLPPYQDAKPPSPASIKKTYTTSKFNDAEPAKGN
LFIGVEVLPENLHLDESETSEEDHGSLEKEKYEQFLSLEEGTKAHYFFEKVVNAAQTWFS
LFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKYNKTIYDVLLHLSGKM
PPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEI
MSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMP
PICVQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIWKNCHKDVIPSERWIVNF
DKDLSDGLVFATQLGAYCPFLIESHFINMYTRPKSPEEYLHNCLIIVNTLYEIDFDVEIQ
VCLRVFPKEMDAGVSGLRKEDMPSVWVVTIRLAVAVARTKRQKKGDIQFACFFVCLFFFI
FVVISFSLWSRMHFFLLLPLDI
Download sequence
Identical sequences A0A182DWE8
gi|27734891|ref|NP_775966.1| ENSP00000324767 9606.ENSP00000324767 ENSP00000367929 NYSGRC-27734891 ENSP00000324767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]