SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000325174 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325174
Domain Number 1 Region: 148-215
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000516
Family Phosphotyrosine-binding domain (PTB) 0.0074
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily PH domain-like 0.000000176
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325174   Gene: ENSG00000146094   Transcript: ENST00000312943
Sequence length 330
Comment pep:known chromosome:GRCh37:5:176928908:176937386:-1 gene:ENSG00000146094 transcript:ENST00000312943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLETPIKDGILYQQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRS
AGPGRRGERRVIRLADCVSVLPADGESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQ
LAFPGTGEASSGSTDAQSPKRGLVPMEENSIYSSWQEVGEFPVVVQRTEAATRCQLKGPA
LLVLGPDAIQLREAKGTQALYSWPYHFLRKFGSDKILLGTPGVSLLICKGERTDDVSGII
LDESLLRAYSVPGAGGHSRVQDSLGPVLREPTFQGERSFLKTSMLRSLLCSCSWRHPRSQ
PRTQASCLQGSDCPAPHRNSTSAAHTLGTS
Download sequence
Identical sequences ENSP00000325174 ENSP00000325174 gi|221554539|ref|NP_001138347.1| NP_001138347.1.87134 NP_001138347.1.92137 XP_005266044.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]