SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000325994 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325994
Domain Number 1 Region: 240-441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-51
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-36
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 165-236
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-25
Family SH3-domain 0.0000378
Further Details:      
 
Domain Number 4 Region: 2-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-24
Family Calponin-homology domain, CH-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325994   Gene: ENSG00000102606   Transcript: ENST00000317133
Sequence length 782
Comment pep:known chromosome:GRCh37:13:111766966:111945783:1 gene:ENSG00000102606 transcript:ENST00000317133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLETFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDS
VCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNED
ELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKG
FDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEE
ICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEE
LGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAF
KNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYL
LLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCN
NQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYH
TLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMK
KLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMH
NHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRKSCCSYISH
QN
Download sequence
Identical sequences ENSP00000325994 ENSP00000325994 gi|22027528|ref|NP_663788.1| NP_663788.1.87134 NP_663788.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]