SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000343656 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343656
Domain Number 1 Region: 215-376,477-729
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-106
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 384-486
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-33
Family Ras-binding domain, RBD 0.00000666
Further Details:      
 
Domain Number 3 Region: 2-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000925
Family DEP domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343656   Gene: ENSG00000136237   Transcript: ENST00000344041
Sequence length 730
Comment pep:known chromosome:GRCh37:7:22157909:22396533:-1 gene:ENSG00000136237 transcript:ENST00000344041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIGVWQLLLDMGIMLSVDQHLYFQDTYVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQ
LVPLIPARGGICELSHQKIEDSEESSDEILVRLTSAVQRELAAVIALKARKSAIEQDEEN
NDKHVAVTEAESVPDSQAGVMCKLQERDEIGRIELVQKLAKENYQFLQTDKKEQEKSEHQ
DDEVTTVQVKEQDQSVLVLKKVQCCGPAPTAGSAESHWRYVVVSGTPEKILEHLLNDLHL
EEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHL
VSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE
YSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILK
VVAEKIQYAEEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAE
NEESQQRSMRILGMNTWDLALELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLL
QRCNEVQLWVATEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSR
LSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPFMPLLLKDVTFIHEG
NKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALF
ELSHRIEPRV
Download sequence
Identical sequences A8MQ07
gi|119392077|ref|NP_036426.3| ENSP00000415664 ENSP00000343656 NP_036426.3.87134 NP_036426.3.92137 XP_005249973.1.92137 ENSP00000343656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]