SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000344429 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344429
Domain Number 1 Region: 363-591
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-61
Family DBL homology domain (DH-domain) 0.000000601
Further Details:      
 
Domain Number 2 Region: 44-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-54
Family Regulator of G-protein signaling, RGS 0.0000000592
Further Details:      
 
Domain Number 3 Region: 592-726
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-38
Family Pleckstrin-homology domain (PH domain) 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344429   Gene: ENSG00000076928   Transcript: ENST00000347545
Sequence length 879
Comment pep:known chromosome:GRCh37:19:42387292:42411606:1 gene:ENSG00000076928 transcript:ENST00000347545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLVLRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQ
LEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTISTDEE
KSAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAAR
WNRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDS
PDREPGADAPLELGDSSPQGPMSLESLAPPESTDEGAETESPEPGDEGEPGRSGLELEPE
EPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFP
LEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISS
RFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQ
SIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDP
MLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRT
LTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCA
LITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLP
FCRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQEN
LLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Download sequence
Identical sequences ENSP00000344429 NP_945328.1.87134 NP_945328.1.92137 ENSP00000344429 gi|39777604|ref|NP_945328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]