SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000345143 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345143
Domain Number 1 Region: 194-314
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345143   Gene: ENSG00000188176   Transcript: ENST00000338859
Sequence length 317
Comment pep:known chromosome:GRCh37:17:4487294:4511614:1 gene:ENSG00000188176 transcript:ENST00000338859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTSNSCIMENGHQPGAGPGDGPPEIAQNFSAPDPPRPRPVSLSLRLPHQPVTAITRVS
DRFSGETSAAALSPMSAATLGGLNPSPSEVITPWTPSPSEKNSSFTWSVPSSGYGAVTAS
KHSNSPPLVTPPQSPVSPQPPAITQVHRQGERRRELVRSQTLPRTSEAQARKALFEKWEQ
ETAAGKGKGEARARLKRSQSFGVASASSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGM
AFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPM
CVFTYVQSLYNHLRRFE
Download sequence
Identical sequences gi|169234649|ref|NP_940903.2| ENSP00000345143 NP_940903.2.87134 NP_940903.2.92137 XP_006721578.1.92137 ENSP00000345143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]