SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348550 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348550
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 220-362
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-24
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family First domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348550   Gene: ENSG00000139926   Transcript: ENST00000356218
Sequence length 614
Comment pep:known chromosome:GRCh37:14:51955855:52197177:1 gene:ENSG00000139926 transcript:ENST00000356218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGRLISDRAA
RYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVV
SKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLT
LGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPM
RSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMDQLEKRSRA
SGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSSMT
SHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDML
MSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDI
RLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYF
SLDLTHDEVPEFVV
Download sequence
Identical sequences K7D5K7
ENSP00000348550 ENSP00000379068 9606.ENSP00000348550 NP_001035946.1.87134 NP_001035946.1.92137 NP_689543.1.87134 NP_689543.1.92137 XP_003831766.1.60992 XP_006720093.1.92137 ENSP00000348550 ENSP00000379068 gi|109715866|ref|NP_001035946.1| gi|22748721|ref|NP_689543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]