SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349677 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349677
Domain Number 1 Region: 200-320
Classification Level Classification E-value
Superfamily EF-hand 9.36e-37
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 289-382
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.5e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 129-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000471
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSP00000349677
Domain Number - Region: 395-433
Classification Level Classification E-value
Superfamily ARM repeat 0.0345
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349677   Gene: ENSG00000196104   Transcript: ENST00000357154
Sequence length 436
Comment pep:known chromosome:GRCh37:4:167654535:168155738:-1 gene:ENSG00000196104 transcript:ENST00000357154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHR
MKEAGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCE
GHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE
DEGDDDDGGDDHDVYI
Download sequence
Identical sequences Q9BQ16
NP_058646.2.87134 NP_058646.2.92137 XP_011530320.1.92137 ENSP00000349677 ENSP00000420920 ENSP00000423421 ENSP00000423606 gi|93141001|ref|NP_058646.2| ENSP00000349677 ENSP00000420920 ENSP00000423421 ENSP00000423606 ENSP00000349677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]