SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000350869 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350869
Domain Number 1 Region: 44-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000188
Family HkH motif-containing C2H2 finger 0.00053
Further Details:      
 
Domain Number 2 Region: 173-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000031
Family HkH motif-containing C2H2 finger 0.011
Further Details:      
 
Domain Number 3 Region: 120-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000456
Family HkH motif-containing C2H2 finger 0.0019
Further Details:      
 
Domain Number 4 Region: 238-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000041
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350869   Gene: ENSG00000113761   Transcript: ENST00000358149
Sequence length 294
Comment pep:known chromosome:GRCh37:5:176449697:176492986:1 gene:ENSG00000113761 transcript:ENST00000358149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREM
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYP
CKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED
Download sequence
Identical sequences Q9UL40
9606.ENSP00000350869 gi|6912440|ref|NP_036411.1| ENSP00000350869 NP_036411.1.87134 NP_036411.1.92137 XP_016864784.1.92137 XP_016864785.1.92137 ENSP00000350869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]