SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000351956 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351956
Domain Number 1 Region: 293-351
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000997
Family BSTI 0.098
Further Details:      
 
Domain Number 2 Region: 660-720
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000687
Family BSTI 0.025
Further Details:      
 
Domain Number 3 Region: 758-821
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000018
Family ATI-like 0.014
Further Details:      
 
Domain Number 4 Region: 344-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family VWC domain 0.064
Further Details:      
 
Domain Number 5 Region: 820-862
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000942
Family VWC domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSP00000351956
Domain Number - Region: 1131-1187
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00123
Family BSTI 0.04
Further Details:      
 
Domain Number - Region: 710-752
Classification Level Classification E-value
Superfamily FnI-like domain 0.00387
Family Fibronectin type I module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351956   Gene: ENSG00000198788   Transcript: ENST00000359061
Sequence length 1780
Comment pep:known chromosome:GRCh37:11:1074902:1093653:1 gene:ENSG00000198788 transcript:ENST00000359061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEETCKSWCTCTQTHTAYHVHTHGKILNQTQDGAFCYWEICGPNGTVEKHFNICSIT
TRPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSD
DGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLC
YDYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPS
PPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTT
PSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTSTPITTTTTTPTPTAITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQSPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTP
TGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPTPTS
TKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTP
Download sequence
Identical sequences ENSP00000351956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]