SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000361115 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361115
Domain Number 1 Region: 107-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000377
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 251-318
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000471
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000023
Family VWC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361115   Gene: ENSG00000101938   Transcript: ENST00000372045
Sequence length 450
Comment pep:known chromosome:GRCh37:X:109917084:110038993:-1 gene:ENSG00000101938 transcript:ENST00000372045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLVYCVNCI
CSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGTTYQHGE
LFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRGDGELSW
EHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQASGTIV
QIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKIHCPNRY
PCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFMEDGETTRKIAL
ETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQI
SQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences A0A2J8KYD2 Q9BU40
ENSP00000361115 ENSP00000361115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]