SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000361580 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361580
Domain Number 1 Region: 104-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 198-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 142-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361580   Gene: ENSG00000164011   Transcript: ENST00000372502
Sequence length 306
Comment pep:known chromosome:GRCh37:1:43316358:43318144:1 gene:ENSG00000164011 transcript:ENST00000372502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQISSGGGGQSRCLLFALGSEMGSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEK
EHGQESLSDELQETHPKKPWQKVTVRARELGDPIAHPRHEADEKPFICAQCGKTFNNTSN
LRTHQRIHTGEKPYKCSECGKSFSRSSNRIRHERIHLEEKHYKCPKCQESFRRRSDLTTH
QQDHLGKRPYRCDICGKSFSQSATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTH
TGERPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKTHLGEQ
AGKDSS
Download sequence
Identical sequences Q5VV50
ENSP00000361580 ENSP00000361582 ENSP00000361582 XP_016856891.1.92137 XP_016856892.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]