SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000363556 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363556
Domain Number 1 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.89e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 113-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 75-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 211-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363556   Gene: ENSG00000169740   Transcript: ENST00000374433
Sequence length 273
Comment pep:known chromosome:GRCh37:10:44139307:44144304:-1 gene:ENSG00000169740 transcript:ENST00000374433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSP
DSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNL
VTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHR
RVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHT
GETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL
Download sequence
Identical sequences A0A024R7T7 A0A0D9REV1 A0A2I3H8A3 A0A2I3LWP1 A0A2J8XTC5 A0A2K5LLI1 A0A2K5P960 A0A2K5ZRX5 A0A2K6DIL3 A0A2K6KU39 A0A2K6Q7L1 F6X466 F7I2L2 G3QRP8 G7PER7 H2Q1U3 P17041
ENSGGOP00000005309 gi|24307925|ref|NP_008904.1| gi|53759141|ref|NP_001005368.1| ENSP00000363556 ENSP00000379143 ENSPTRP00000004206 ENSGGOP00000005309 ENSP00000363556 ENSPANP00000020159 ENSCJAP00000029980 ENSPTRP00000004206 ENSP00000363556 ENSP00000379143 ENSMMUP00000029529 NP_001005368.1.87134 NP_001005368.1.92137 NP_001247851.1.72884 NP_008904.1.87134 NP_008904.1.92137 XP_003271222.1.23891 XP_003312598.1.37143 XP_003816788.1.60992 XP_003816789.1.60992 XP_004049358.1.27298 XP_004049359.1.27298 XP_005565147.1.63531 XP_005565148.1.63531 XP_005565149.1.63531 XP_007960667.1.81039 XP_007960668.1.81039 XP_007960669.1.81039 XP_009007761.1.60252 XP_009456668.1.37143 XP_010374437.1.97406 XP_010374438.1.97406 XP_011747786.1.29376 XP_011747787.1.29376 XP_011747788.1.29376 XP_011833963.1.47321 XP_011884685.1.92194 XP_011884686.1.92194 XP_011884687.1.92194 XP_015002382.1.72884 XP_015002383.1.72884 XP_016872105.1.92137 XP_017373799.1.71028 XP_017373800.1.71028 XP_017373801.1.71028 XP_017373802.1.71028 XP_017704531.1.44346 XP_017704532.1.44346 XP_017834386.1.60252 XP_529310.3.37143 ENSNLEP00000019285 9544.ENSMMUP00000029529 9598.ENSPTRP00000004206 9606.ENSP00000363556 ENSMMUP00000029529 ENSNLEP00000019285 hsi002014866.1 hsi002014866.2 ENSCJAP00000029980 ENSCJAP00000045930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]