SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000365510 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365510
Domain Number 1 Region: 250-316
Classification Level Classification E-value
Superfamily FnI-like domain 4.19e-16
Family VWC domain 0.0044
Further Details:      
 
Domain Number 2 Region: 32-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000293
Family VWC domain 0.016
Further Details:      
 
Domain Number 3 Region: 109-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000123
Family VWC domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365510   Gene: ENSG00000054938   Transcript: ENST00000376332
Sequence length 429
Comment pep:known chromosome:GRCh37:11:74407474:74442430:-1 gene:ENSG00000054938 transcript:ENST00000376332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLR
CTCSEGAHVSCYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQH
GEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASE
QSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTV
KIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPC
RHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEA
SDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVT
ASPDKVTKT
Download sequence
Identical sequences Q6WN34
ENSP00000365510 NP_001265402.1.87134 NP_001265402.1.92137 ENSP00000365510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]