SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000367812 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367812
Domain Number 1 Region: 97-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-55
Family DBL homology domain (DH-domain) 0.0000413
Further Details:      
 
Domain Number 2 Region: 289-417
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-26
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367812   Gene: ENSG00000090924   Transcript: ENST00000378550
Sequence length 577
Comment pep:known chromosome:GRCh37:19:39903750:39915934:1 gene:ENSG00000090924 transcript:ENST00000378550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAPAAPTMASPRGSGSSTSLSTVGS
EGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSARPSRLERVAREIVETERAYVRD
LRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLENSSSAGGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLRHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWAEGPGTGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRL
GGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGLEYTYKGHI
FCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPVLEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSVIRRGRR
QSEPVKDPYVMFPQNAKPGFKHAGSEGELYPPESQPPVSGSAPPEDLEDAGPPTLDPSGT
SITEEILELLNQRGLRDPGESMGLHRAQGAPDAPFHM
Download sequence
Identical sequences ENSP00000386492 ENSP00000367812 ENSP00000386492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]