SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000374423 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374423
Domain Number 1 Region: 310-503
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 136-276
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.66e-28
Family CRAL/TRIO domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374423   Gene: ENSG00000241484   Transcript: ENST00000389773
Sequence length 555
Comment pep:known chromosome:GRCh37:22:45098382:45258664:1 gene:ENSG00000241484 transcript:ENST00000389773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNE
GVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEELQRDKAAAAAVLGAVRKRPSV
VPMAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYL
KYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYVVHPTSFIK
VLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPP
TKTPPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQ
TVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSL
RVTGCRQILRSLPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIWPSQGVS
SLSALVPLNMFTELLIEYYEKIFSTPEAPGEHGLAPWEQGSRAAPLQEAVPRTQATGLTK
PTLPPSPLMAARRRL
Download sequence
Identical sequences ENSP00000374423 gi|226423858|ref|NP_851851.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]