SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000377083 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377083
Domain Number 1 Region: 415-901
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-165
Family ALDH-like 0.000000000726
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 1.01e-50
Family Formyltransferase 0.00000000214
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.04e-25
Family Post formyltransferase domain 0.000000881
Further Details:      
 
Domain Number 4 Region: 325-408
Classification Level Classification E-value
Superfamily ACP-like 0.00000576
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377083   Gene: ENSG00000144908   Transcript: ENST00000393434
Sequence length 902
Comment pep:known chromosome:GRCh37:3:125822416:125899645:-1 gene:ENSG00000144908 transcript:ENST00000393434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
LASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKI
SARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGATLVCGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
Download sequence
Identical sequences O75891
NP_036322.2.87134 NP_036322.2.92137 XP_006713544.1.92137 XP_011510657.1.92137 9606.ENSP00000377083 ENSP00000377083 ENSP00000420293 ENSP00000377083 ENSP00000420293 gi|21614513|ref|NP_036322.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]