SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379501 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379501
Domain Number 1 Region: 128-527
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.3e-111
Family GABA-aminotransferase-like 0.0000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379501   Gene: ENSG00000158578   Transcript: ENST00000396198
Sequence length 574
Comment pep:novel chromosome:GRCh37:X:55035488:55057410:-1 gene:ENSG00000158578 transcript:ENST00000396198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGEVALGWNKKKRLFCEDFRFKMVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIG
RCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDV
KAFKTGNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSV
WCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSAL
LFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKL
LEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVGLYGSRGAGIG
ERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALE
SVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAALNSKLCDLL
LSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVA
ACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA
Download sequence
Identical sequences NP_001033057.1.87134 NP_001033057.1.92137 ENSP00000379501 gi|83977444|ref|NP_001033057.1| ENSP00000379501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]