SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000384293 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384293
Domain Number 1 Region: 145-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-99
Family Protein kinases, catalytic subunit 0.0000000000568
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-24
Family Pleckstrin-homology domain (PH domain) 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384293   Gene: ENSG00000142208   Transcript: ENST00000407796
Sequence length 480
Comment pep:known chromosome:GRCh37:14:105235686:105262016:-1 gene:ENSG00000142208 transcript:ENST00000407796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences A0A2J8SZ71 B0LPE5 G1S2V0 G3RB32 K7AGW5 P31749
NP_001014431.1.87134 NP_001014431.1.92137 NP_001014432.1.87134 NP_001014432.1.92137 NP_005154.2.87134 NP_005154.2.92137 XP_003807047.1.60992 XP_005267458.1.92137 XP_012353538.1.23891 XP_016782303.1.37143 XP_016782304.1.37143 XP_016782305.1.37143 XP_018865051.1.27298 ENSP00000270202 ENSP00000384293 ENSP00000385326 ENSP00000450688 ENSP00000451166 ENSP00000451828 ENSGGOP00000012669 ENSGGOP00000017521 ENSP00000270202 ENSP00000384293 ENSP00000385326 ENSP00000450688 ENSP00000451166 ENSP00000451828 9606.ENSP00000270202 ENSNLEP00000019838 ENSP00000270202 ENSNLEP00000019838 gi|62241011|ref|NP_005154.2| gi|62241013|ref|NP_001014431.1| gi|62241015|ref|NP_001014432.1| ENSGGOP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]