SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000384515 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384515
Domain Number 1 Region: 70-239,285-395
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-52
Family Calponin-homology domain, CH-domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384515   Gene: ENSG00000188677   Transcript: ENST00000406477
Sequence length 397
Comment pep:known chromosome:GRCh37:22:44395091:44564803:1 gene:ENSG00000188677 transcript:ENST00000406477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHVFKDHQRGEKRGFLSPENKNCRRLELRRGCSCSWGLCSQALMASLAGSLLPGSDRSG
VETSEYAQGGVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFK
ELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQ
KLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQV
VVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKH
LNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELML
DGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Download sequence
Identical sequences NP_001003828.1.87134 NP_001003828.1.92137 gi|51477696|ref|NP_001003828.1| 9606.ENSP00000384515 ENSP00000384515 ENSP00000384515 ENSP00000342492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]