SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387316 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387316
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily MIT domain 6.41e-26
Family MIT domain 0.0000183
Further Details:      
 
Weak hits

Sequence:  ENSP00000387316
Domain Number - Region: 124-183
Classification Level Classification E-value
Superfamily PHP domain-like 0.0549
Family PHP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387316   Gene: ENSG00000158411   Transcript: ENST00000409107
Sequence length 197
Comment pep:novel chromosome:GRCh37:2:99785908:99797513:-1 gene:ENSG00000158411 transcript:ENST00000409107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCN
LREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI
EDPYIRHTHQGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGR
GLDYFKKPQSRFSLGYC
Download sequence
Identical sequences B8ZZL5
ENSP00000387316 ENSP00000387316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]