SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000397615 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397615
Domain Number 1 Region: 89-127
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000327
Family DBL homology domain (DH-domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397615   Gene: ENSG00000090924   Transcript: ENST00000438123
Sequence length 127
Comment pep:novel chromosome:GRCh37:19:39904168:39905900:1 gene:ENSG00000090924 transcript:ENST00000438123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAAPAAPTMASPRGSGSSTSLSTVG
SEGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSARPSRLERVAREIVETERAYVR
DLRSIVE
Download sequence
Identical sequences C9J7S4
ENSP00000397615 ENSP00000397615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]