SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397824 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397824
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily E set domains 2.61e-30
Family Filamin repeat (rod domain) 0.0000506
Further Details:      
 
Domain Number 2 Region: 176-268
Classification Level Classification E-value
Superfamily E set domains 1.53e-28
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 3 Region: 112-189
Classification Level Classification E-value
Superfamily E set domains 1.6e-21
Family Filamin repeat (rod domain) 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397824   Gene: ENSG00000196924   Transcript: ENST00000444578
Sequence length 281
Comment pep:novel chromosome:GRCh37:X:153579949:153581537:-1 gene:ENSG00000196924 transcript:ENST00000444578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGG
LSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPEISIQDMTAQVTS
PSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHK
VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQ
EPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQ
Download sequence
Identical sequences A0A2J8IN82 A0A2J8RLT4 H0Y5C6
ENSP00000397824 ENSP00000397824 ENSP00000470886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]