SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000399739 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399739
Domain Number 1 Region: 113-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000398
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 257-324
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000471
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 35-101
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000023
Family VWC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399739   Gene: ENSG00000101938   Transcript: ENST00000444321
Sequence length 457
Comment pep:known chromosome:GRCh37:X:109919285:110039047:-1 gene:ENSG00000101938 transcript:ENST00000444321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGT
TYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRG
DGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQ
ASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKI
HCPNRYPCKYPQKIDGKCCKVCPGKKAKEELPGQSFDNKGYFCGEETMPVYESVFMEDGE
TTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIF
TEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences A0A2J8KYC8
gi|221316563|ref|NP_001137454.1| ENSP00000399739 NP_001137454.1.87134 NP_001137454.1.92137 XP_005262279.1.92137 XP_008973789.1.60992 XP_008973790.1.60992 XP_016799415.1.37143 XP_016799416.1.37143 ENSP00000399739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]