SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401303 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401303
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 6.29e-64
Family Phosphotyrosine-binding domain (PTB) 0.0000000059
Further Details:      
 
Domain Number 2 Region: 472-577
Classification Level Classification E-value
Superfamily SH2 domain 7.81e-28
Family SH2 domain 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401303   Gene: ENSG00000160691   Transcript: ENST00000448116
Sequence length 584
Comment pep:novel chromosome:GRCh37:1:154934774:154943223:-1 gene:ENSG00000160691 transcript:ENST00000448116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPAGR
ELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences ENSP00000401303 9606.ENSP00000401303 NP_001123512.1.87134 NP_001123512.1.92137 ENSP00000401303 gi|194239664|ref|NP_001123512.1| ENSP00000357430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]