SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407972 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407972
Domain Number 1 Region: 23-173
Classification Level Classification E-value
Superfamily PHP domain-like 1.57e-31
Family RNase P subunit p30 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407972   Gene: ENSG00000148688   Transcript: ENST00000414836
Sequence length 212
Comment pep:known chromosome:GRCh37:10:92635315:92660523:1 gene:ENSG00000148688 transcript:ENST00000414836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVF
PKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMR
RYTISSALNLMQICKGKPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRK
TAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
Download sequence
Identical sequences Q5VU10
ENSP00000407972 ENSP00000407972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]