SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410930 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410930
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-22
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410930   Gene: ENSG00000152767   Transcript: ENST00000423063
Sequence length 215
Comment pep:putative chromosome:GRCh37:13:99083297:99088355:1 gene:ENSG00000152767 transcript:ENST00000423063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQV
LERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVV
PGRVSSSGLTMHCAGSRKEASEGLTFEPFEERPLQSKMSSFHPPGRQLEKHNSVVSSESL
CSEEIKQSSDLIFCFFSLRGDSLLYLFPYHIPQKI
Download sequence
Identical sequences H0Y783
ENSP00000410930 ENSP00000410930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]