SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415356 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415356
Domain Number 1 Region: 54-129
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.7e-18
Family Ribosomal protein L11, C-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 16-57
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00000000000301
Family Ribosomal L11/L12e N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415356   Gene: ENSG00000174547   Transcript: ENST00000430466
Sequence length 166
Comment pep:known chromosome:GRCh37:11:66202546:66206319:-1 gene:ENSG00000174547 transcript:ENST00000430466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPT
VSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIG
SARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK
Download sequence
Identical sequences K7A6E7
NP_733934.1.87134 NP_733934.1.92137 XP_001171575.1.37143 XP_003828730.1.60992 gi|25306272|ref|NP_733934.1| ENSP00000415356 ENSP00000415356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]